PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00026166001
Common NameGSBRNA2T00026166001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 358aa    MW: 40591.3 Da    PI: 5.3492
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00026166001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.82.7e-36381371100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          aC+aCk++rr+Ca+dC+lapyfpaeqpk f+nvh lFG++ ++k+l++l+e ++++am+s+++++ +r r+P++G++g+ ++lq  +  +
  GSBRNA2T00026166001  38 ACSACKYQRRRCATDCPLAPYFPAEQPKIFQNVHSLFGVRSIIKILENLDEAQKPEAMKSIIFQSYVRDRNPIHGCLGITQQLQYMIWLA 127
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          ++el++++++
  GSBRNA2T00026166001 128 EEELKMINSQ 137
                          ****999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.49237138IPR004883Lateral organ boundaries, LOB
PfamPF031958.2E-3438135IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MSQIKTIHNL IGSLEKLLDL LLLSLIIFMT LKGGTSGACS ACKYQRRRCA TDCPLAPYFP  60
AEQPKIFQNV HSLFGVRSII KILENLDEAQ KPEAMKSIIF QSYVRDRNPI HGCLGITQQL  120
QYMIWLAEEE LKMINSQLQI HRNNTNTWQY HHNAHNQMSH EIGEKLEDVT SQLNLGVGLM  180
VNNNQNNTIP FFSPLPVFER QPQQPQMSYT YSSSEINNNC YSSPVYTDSC KEILTTNNNN  240
VDASLAWGQN RFPYHHNNGF SNQNEHCNET KSNNGVTAIQ SQLVNHQMVS NQQDEVDDVE  300
YDEIHQFLEI IDDKQSFPDT KLTYASSSGE SLKERTDETG ESELRSAATC FSLTSVN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591366.10.0PREDICTED: LOB domain-containing protein 27-like isoform X2
SwissprotQ9STS61e-125LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A078J5G00.0A0A078J5G0_BRANA; BnaC01g42830D protein
STRINGBra018102.1-P1e-164(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-112LOB domain-containing protein 27
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]